explainerbeginner
When Not to Use AI: The Marketing Tasks Worth Keeping Human
An honest map of the marketing work where AI subtracts value — crisis response, relationship touchpoints, strategy formation, and the places where the effort is the message.
strategyjudgmentbrandmarketing leader
guideintermediate
AI for B2B Marketing: Where It Actually Works
B2B's long cycles, small audiences, and committee buying change what AI is good for. A practical map of the B2B use cases that pay off — and the B2C imports that don't.
b2babmlead-generationgrowth marketer
workflowbeginner
The AI Newsletter Production Workflow: Weekly Issue in Two Hours
An end-to-end workflow for producing a quality weekly newsletter with AI handling curation, drafting, and QA — while the voice stays unmistakably human.
newsletteremailcurationcontent marketer
workflowintermediate
Build a Lead Enrichment Agent That Prioritizes Your Pipeline
Set up an AI agent that automatically researches every new lead, fills in firmographic and intent context, scores fit, and routes the best ones to sales with a briefing.
lead-enrichmentai-agentslead-scoringmarketing ops manager
learning-pathintermediate
The CRM & Lifecycle Marketer's AI Path
A staged learning path for CRM and lifecycle marketers: from AI-assisted segmentation and copy to self-improving nurture loops and lifecycle agents.
crmlifecycleemailcrm lifecycle marketer
roundupbeginner
This Week in AI Marketing #09: Lifecycle Gets a Brain
AI moves into lifecycle and CRM marketing — adaptive sends, generated segments, and the new discipline of reviewing what the model decided.
lifecycle-marketingweekly-roundupcrmcrm lifecycle marketer
explainerintermediate
Personalization at Scale Finally Works. Here's What It Actually Takes.
AI made one-to-one personalization technically possible. The teams making it work treat it as a data and governance problem, not a copy problem.
personalizationsegmentationdatacrm lifecycle marketer
workflowintermediate
The Self-Improving Email Nurture Loop
Build an email nurture sequence that rewrites itself: AI drafts variants, engagement data picks winners, and the losers get replaced automatically every cycle.
email-marketingnurture-sequencesmarketing-loopscrm lifecycle marketer
roundupbeginner
This Week in AI Marketing #07: Workflows Beat Prompts
Marketing automation rebuilds around AI-native workflows, plus notes on context management, connector sprawl, and a stat on time reclaimed.
marketing-automationweekly-roundupworkflowsmarketing ops manager
guideintermediate
AI Agents for CRM and Lifecycle Marketing: A Practical Guide
How lifecycle and CRM teams are using AI agents for segmentation, journey orchestration, win-back, and retention — with real deployment patterns and guardrails.
ai-agentscrmlifecycle-marketingcrm lifecycle marketer
tool-analysisintermediate
n8n vs Make vs Zapier for AI Marketing Workflows
A head-to-head comparison of n8n, Make, and Zapier for building AI-powered marketing automations — pricing models, AI capabilities, and which teams should pick which.
n8nmakezapiermarketing ops manager
glossarybeginner
Prompt Engineering
Prompt engineering is the practice of designing inputs to AI models — context, examples, instructions, and constraints — to reliably produce useful, on-brand outputs.
prompt-engineeringllm-basicsdefinitionscontent marketer
guidebeginner
Prompt Engineering for Marketers: Patterns That Actually Work
Practical prompt patterns for marketing tasks — briefs, rewrites, analysis, and campaign ideation — with copy-paste templates and the mistakes to avoid.
prompt-engineeringai-contentproductivitycontent marketer
guidebeginner
AI Email Marketing: A Practical Guide to the Whole Program
How to apply AI across your email program — ideation, copy, personalization, send-time, deliverability, and reporting — with realistic expectations at each step.
email-marketingai-copywritingpersonalizationcrm lifecycle marketer
tool-analysisbeginner
AI Email Marketing Tools in 2026: What's Real Behind the 'AI-Powered' Label
A clear-eyed guide to AI features in email marketing platforms — which capabilities move revenue, which are demo-ware, and how to evaluate the 2026 field.
email-marketingai-copywritinglifecycle-marketingcrm lifecycle marketer
trend-notebeginner
The Rise of Prompt Ops
Prompt and context management is hardening into a marketing ops discipline — with libraries, versioning, and quality gates replacing tribal knowledge.
prompt-opsmarketing-opsai-workflowsmarketing ops manager