explainerbeginner
The Marketing Skills That Matter Now: What AI Made Valuable and What It Made Cheap
AI repriced the marketing skill market. An honest inventory of which capabilities gained value, which collapsed, and how to reposition — for individuals and for hiring managers.
careersskillshiringmarketing leader
explainerbeginner
The State of AI Marketing, Mid-2026: What's Real, What's Noise, What's Next
A clear-eyed mid-year assessment of AI in marketing: which capabilities crossed into production, which promises stalled, and where the next twelve months are heading.
state-of-industrystrategyagentsmarketing leader
explainerbeginner
When Not to Use AI: The Marketing Tasks Worth Keeping Human
An honest map of the marketing work where AI subtracts value — crisis response, relationship touchpoints, strategy formation, and the places where the effort is the message.
strategyjudgmentbrandmarketing leader
guidebeginner
The AI Content Refresh Strategy: Your Old Posts Are Your Best Asset
Why refreshing existing content with AI beats producing new content for most sites — and the systematic process for doing it at scale without wrecking what works.
content-refreshseogeocontent marketer
guideintermediate
AI for B2B Marketing: Where It Actually Works
B2B's long cycles, small audiences, and committee buying change what AI is good for. A practical map of the B2B use cases that pay off — and the B2C imports that don't.
b2babmlead-generationgrowth marketer
guidebeginner
AI Image Generation for Marketers: A Working Playbook
Where AI image generation genuinely works in marketing, where it embarrasses brands, and the brief-to-asset process that keeps quality and consistency high.
image-generationcreativedesigncontent marketer
guideintermediate
How to Run an AI Visibility Audit
A step-by-step process for auditing what ChatGPT, Perplexity, Gemini, and AI Overviews say about your brand — and turning the findings into a GEO action plan.
geoauditai-answer-shareseo geo strategist
guideintermediate
Measuring AI Marketing ROI: A Framework That Survives the CFO
How to measure what AI actually returns in marketing — time, quality, and outcome tiers, honest baselines, and the costs teams forget to count.
roimeasurementbudgetingmarketing leader
workflowbeginner
Content Refresh Workflow: Reviving a Decayed Post, Step by Step
The operational workflow for refreshing one decayed post with AI — fact audit, gap analysis, surgical rewrite, and schema update — in about 90 minutes.
content-refreshseogeocontent marketer
workflowbeginner
The AI Newsletter Production Workflow: Weekly Issue in Two Hours
An end-to-end workflow for producing a quality weekly newsletter with AI handling curation, drafting, and QA — while the voice stays unmistakably human.
newsletteremailcurationcontent marketer
workflowbeginner
Webinar-to-Everything: The AI Repurposing Workflow for Events
Turn one webinar or event session into a month of content — recap article, clips, social posts, email sequence, and FAQ — with AI handling the transformation.
webinarrepurposingeventscontent marketer
tool-analysisbeginner
AI SEO Tools in 2026: The Landscape After the Answer-Engine Shift
How the SEO tool stack reorganized around AI — what the categories are now, which capabilities matter, and how to build a stack without paying for overlap.
seotoolsgeoseo geo strategist
tool-analysisbeginner
Perplexity for Marketers: The Research Tool and the Visibility Channel
Perplexity matters to marketers twice — as a daily research tool with citations built in, and as an answer surface where your brand is either present or absent.
perplexityresearchgeocontent marketer
glossary
AI Slop
AI slop is low-quality, high-volume AI-generated content published without editing, verification, or original value — and increasingly discounted by both audiences and algorithms.
content-qualityai-contentslopcontent marketer
glossary
Chain of Thought
Chain of thought is an AI technique where the model works through intermediate reasoning steps before answering — improving accuracy on complex marketing analysis tasks.
chain-of-thoughtreasoningpromptscontent marketer
glossary
Guardrails
Guardrails are the enforced constraints on what an AI system may say or do — approved claims, banned actions, tone rules, and hard limits that hold regardless of the prompt.
guardrailsgovernancesafetymarketing ops manager
glossary
Human-in-the-Loop (HITL)
Human-in-the-loop is a system design where AI does the work but a person reviews or approves defined steps — the standard safety pattern for marketing AI.
hitlgovernanceworkflow-designmarketing ops manager
glossary
Model Drift
Model drift is the gradual or sudden change in an AI system's output behavior over time — from provider updates, data shifts, or accumulating context — degrading workflows that once worked.
model-driftqualityoperationsmarketing ops manager
glossary
Synthetic Data
Synthetic data is artificially generated data that mimics real data's patterns — used in marketing for testing, privacy-safe analysis, and simulated audience research.
synthetic-dataresearchprivacyanalytics lead
trend-notebeginner
Ads Are Coming to AI Answers. Marketers Should Plan for Both Outcomes.
Answer engines are experimenting with sponsored placements inside AI responses. What's happening, why monetization pressure makes it inevitable, and how to prepare.
ai-adsanswer-enginespaid-mediapaid media specialist
glossary
AI Answer Share
AI answer share is the percentage of relevant AI-generated answers in your category that mention or recommend your brand — the AI era's share of voice.
geomeasurementmetricsseo geo strategist
roundupbeginner
This Week in AI Marketing #11: The Mid-Year Reality Check
A mid-2026 stocktake: what actually changed in AI marketing this half, what was noise, and the one capability gap that will define H2.
weekly-roundupai-strategymid-year-reviewmarketing leader
guidebeginner
Building a Team Prompt Library That People Actually Use
How to turn scattered individual prompts into a shared, versioned prompt library — the fastest way to raise your whole marketing team's AI output quality.
promptsprompt-libraryteammarketing ops manager
explainerintermediate
Buy vs Build: The Marketing Agent Decision, Honestly
Should your team buy packaged AI agent products or build on frameworks and automation platforms? A decision framework based on what actually predicts success.
agentsstrategytoolingmarketing leader
glossarybeginner
Multimodal AI
Multimodal AI models understand and generate multiple media types — text, images, audio, and video — powering modern creative production and analysis for marketers.
multimodal-aiai-creativegenerative-videocontent marketer
tool-analysisbeginner
AI Research Tools for Marketers: Deep Research, Notebooks, and Where Each Fits
A practical guide to AI research tooling for marketing — deep research agents, NotebookLM-style workspaces, and Perplexity — and how to use them without inheriting their errors.
ai-researchnotebooklmdeep-researchcontent marketer
trend-notebeginner
GEO Becomes Standard Practice
Generative engine optimization is moving from experiment to budget line item, with owners, agencies, and reporting expectations attached.
geoai-searchbudgetsseo geo strategist
guideintermediate
Schema Markup for GEO: A Practical Setup Guide
Which schema.org types actually matter for AI answer visibility, how to implement them, and the consistency rules that make machines trust your facts.
schemastructured-datageoseo geo strategist
explaineradvanced
Agent Governance and Brand Safety: Guardrails for AI That Acts in Your Name
When AI agents publish, respond, and spend on behalf of your brand, governance stops being a policy document. A practical guardrail architecture for marketing agents.
agent-governancebrand-safetyguardrailsmarketing leader
glossary
Zero-Click Search
Zero-click search is when a user's question is answered directly on the search or AI surface, ending the session without a click to any website.
zero-clickseogeoseo geo strategist
explainerintermediate
Marketing When AI Answers First
More buying journeys now start — and increasingly end — inside an AI answer. A strategy guide for marketing where the answer is the touchpoint.
geoaeozero-clickseo geo strategist
trend-notebeginner
AI Marketing Trends: June 2026
The most significant shifts in AI marketing in June 2026 — from agentic workflows entering mainstream stacks to GEO becoming a standard practice.
trendsjune-2026agentsmarketing leader
guideintermediate
AI-Powered Competitor Analysis: From Monthly Chore to Living System
How to use AI to run continuous competitor intelligence — positioning shifts, pricing changes, content strategy, and AI-answer presence — without a research team.
competitive-intelligenceagentsresearchgrowth marketer
workflowintermediate
Build a Lead Enrichment Agent That Prioritizes Your Pipeline
Set up an AI agent that automatically researches every new lead, fills in firmographic and intent context, scores fit, and routes the best ones to sales with a briefing.
lead-enrichmentai-agentslead-scoringmarketing ops manager
tool-analysisintermediate
GEO Tracking Tools in 2026: Measuring Your Brand in AI Answers
A practical review of the tools that track brand visibility inside ChatGPT, AI Overviews, Perplexity, and other AI answers — what they measure well, and where the data is still shaky.
geoai-visibilitybrand-monitoringseo geo strategist
roundupbeginner
This Week in AI Marketing #10: When Your Visitor Is a Bot (and That's Fine)
Agent traffic becomes a real audience segment, plus notes on machine-readable pages, analytics hygiene, and agent-friendly conversion paths.
ai-agentsweekly-roundupagent-trafficanalytics lead
glossarybeginner
Context Window
A context window is the amount of text an AI model can consider at once — the working memory that limits how much brand, data, and campaign context you can supply.
context-windowllm-basicsdefinitionscontent marketer
guideintermediate
AI for Marketing Analytics and Reporting: From Dashboards to Answers
How marketing teams use AI agents for analytics — natural-language querying, automated reporting, anomaly detection — and the trust problems you must solve first.
marketing-analyticsai-reportingdata-agentsanalytics lead
glossary
Structured Data (Schema Markup)
Structured data is machine-readable code (usually JSON-LD following schema.org) added to web pages so search and AI systems can understand content unambiguously.
schemaseogeoseo geo strategist
explainerintermediate
AI Marketing Metrics That Matter: Measuring the Machine-Era Program
The metrics that actually capture AI's impact on marketing — from AI-answer visibility share to workflow unit costs — and the vanity numbers to retire.
marketing-metricsmeasurementai-visibilityanalytics lead
roundup
This Week in AI Marketing — Issue 01
The most important AI-in-marketing developments this week: new tools, notable use cases, and what they mean for your team.
roundupweeklynewsmarketing leader
trend-notebeginner
Agentic Commerce Rising
AI agents that research, compare, and buy on a user's behalf are emerging — and they change who marketing actually has to persuade.
agentic-commerceai-agentsecommercegrowth marketer
learning-pathintermediate
Analytics AI Path: From Report Builder to Insight System Architect
A staged path for marketing analytics leads: use LLMs for analysis and narrative, automate the reporting layer with agents, and build a self-improving insight practice.
analyticsreportingai-agentsanalytics lead
tool-analysisintermediate
CrewAI for Marketing Teams: Multi-Agent Workflows Beyond the Demo
An honest analysis of CrewAI for marketing teams — what the multi-agent 'crews' framework actually delivers, what it costs, and who should adopt it.
crewaimulti-agentagentic-workflowmarketing ops manager
learning-pathintermediate
The CRM & Lifecycle Marketer's AI Path
A staged learning path for CRM and lifecycle marketers: from AI-assisted segmentation and copy to self-improving nurture loops and lifecycle agents.
crmlifecycleemailcrm lifecycle marketer
workflowadvanced
The AI Paid Ads Creative Testing Loop: Generate, Test, Learn, Repeat
An advanced closed-loop system where AI generates ad creative variants from a concept matrix, structured tests pick winners, and performance data trains the next generation round.
paid-adscreative-testingad-creativepaid media specialist
roundupbeginner
This Week in AI Marketing #09: Lifecycle Gets a Brain
AI moves into lifecycle and CRM marketing — adaptive sends, generated segments, and the new discipline of reviewing what the model decided.
lifecycle-marketingweekly-roundupcrmcrm lifecycle marketer
glossarybeginner
Agentic Workflow
An agentic workflow is an AI process where a model plans, uses tools, and iterates toward a goal — deciding its own steps rather than following a fixed script.
agentic-workflowai-agentsautomationmarketing ops manager
guideintermediate
Building Your First Marketing Agent: A Step-by-Step Guide
A practical walkthrough for shipping your first AI marketing agent — a no-code path and a code path, with scoping advice, guardrails, and a realistic timeline.
ai-agentsno-codeagent-buildingmarketing ops manager
tool-analysisintermediate
AI Ad Creative Tools in 2026: Volume Is Solved, Judgment Isn't
A working review of the AI ad creative stack — generation, iteration, and pre-flight testing tools — and how paid teams should actually deploy them.
ad-creativepaid-mediacreative-testingpaid media specialist
tool-analysisbeginner
AI Social Media Tools: The 2026 Landscape
A structured breakdown of the AI tools social media marketers are actually using in 2026 — by use case, not just by brand name.
toolssocial-medialandscapesocial media manager
glossary
E-E-A-T
E-E-A-T (Experience, Expertise, Authoritativeness, Trustworthiness) is Google's framework for content quality — and increasingly the pattern AI answer engines reward too.
eeatcontent-qualityseocontent marketer
learning-pathintermediate
Paid Media AI Path: From Campaign Manager to AI-Leveraged Buyer
A staged path for paid media specialists: work with platform automation instead of against it, build an AI creative engine, and automate analysis and reporting.
paid-mediaad-creativecreative-testingpaid media specialist
trend-notebeginner
The AI Search Traffic Shift
Organic clicks are declining as AI answers absorb informational queries — and AI-answer visibility is emerging as the replacement metric.
ai-searchorganic-trafficzero-clickseo geo strategist
guideintermediate
AI in Paid Media: Creative Generation, Bidding, and Testing That Works
How paid media teams use AI across creative generation, automated bidding, and testing in 2026 — what to automate, what to keep human, and where budgets leak.
paid-mediaad-creativeautomated-biddingpaid media specialist
learning-pathintermediate
CMO AI Strategy Path: Leading a Marketing Org Through AI
A learning path for marketing leaders: build a credible AI strategy, redesign team structure and skills, and put governance in place before an incident does it for you.
marketing-leadershipai-strategyteam-designmarketing leader
workflowintermediate
Social Media Calendar Agent: End-to-End Workflow
A step-by-step workflow for using an AI agent to plan, draft, and schedule a month of social content from a campaign brief.
social-mediaagentsautomationsocial media manager
workflowbeginner
Video Repurposing Workflow: One Long Video Into 15 Assets
A step-by-step workflow for turning a single webinar, podcast, or long-form video into clips, shorts, social posts, and an article using AI tools — in about two hours.
video-repurposingshort-form-videocontent-atomizationcontent marketer
tool-analysisbeginner
Claude vs ChatGPT for Marketing Work: An Honest Comparison
Where Claude and ChatGPT each genuinely excel for marketing tasks — writing, research, analysis, and workflow — without fanboy scoring.
claudechatgptai-assistantscontent marketer
roundupbeginner
This Week in AI Marketing #08: The GEO Budget Line Appears
GEO shows up as a named budget line and job responsibility, plus notes on llms.txt, citation-worthy formatting, and measurement honesty.
geoweekly-roundupai-searchseo geo strategist
learning-pathbeginner
The AI Video & Creative Path
A staged learning path for marketers building AI-powered video and creative production: from first generations to a repeatable creative pipeline.
videocreativelearning-pathcontent marketer
glossarybeginner
Google AI Overviews
AI Overviews are Google's AI-generated answer summaries at the top of search results — reshaping click-through rates and how brands earn search visibility.
ai-overviewsgoogle-searchserpseo geo strategist
explainerintermediate
Is the Marketing Funnel Dead? What AI Answers Actually Compress
AI answers collapse the research phase of buying journeys. What that compression really means for funnel strategy — and what survives it.
marketing-funnelbuyer-journeyai-searchmarketing leader
guideintermediate
The GEO Content Checklist: 14 Signals AI Engines Reward
A page-by-page checklist of the 14 on-page and off-page signals that make content more likely to be cited by ChatGPT, Perplexity, and Google AI Overviews.
geocontent-optimizationai-citationsseo geo strategist
glossary
Grounding
Grounding is constraining an AI model's output to verified source material — documents, data, or search results — so responses are anchored in fact rather than the model's memory.
groundingragaccuracycontent marketer
learning-pathintermediate
Marketing Ops AI Path: The Ops Manager's Automation Roadmap
A staged path for marketing ops managers: from adding AI steps to existing automations, to building agentic workflows, to governing an AI-powered ops stack.
marketing-opsautomationai-workflowsmarketing ops manager
trend-notebeginner
Synthetic Personas in Market Research
AI-simulated customer personas are entering the research workflow — fast and cheap for early exploration, risky as a substitute for real customers.
synthetic-personasmarket-researchai-agentsgrowth marketer
explainerintermediate
Personalization at Scale Finally Works. Here's What It Actually Takes.
AI made one-to-one personalization technically possible. The teams making it work treat it as a data and governance problem, not a copy problem.
personalizationsegmentationdatacrm lifecycle marketer
guidebeginner
AI for Social Media: Where to Start
How social media marketers can start using AI for content planning, caption writing, and performance analysis — without overhauling their workflow.
social-mediacontentbeginnersocial media manager
workflowintermediate
Social Listening Agent: From Mentions to Actions Automatically
Build an AI agent that monitors brand mentions and sentiment across social platforms and communities, classifies what matters, and routes each mention to the right action.
social-listeningsentiment-analysisai-agentssocial media manager
tool-analysisintermediate
AI Analytics Copilots for Marketing: What They Answer and What They Get Wrong
An honest look at AI analytics copilots for marketing teams — where natural-language querying delivers, where it hallucinates, and how to adopt without breaking trust in your data.
analyticsai-copilotsmarketing-dataanalytics lead
workflowintermediate
The Self-Improving Email Nurture Loop
Build an email nurture sequence that rewrites itself: AI drafts variants, engagement data picks winners, and the losers get replaced automatically every cycle.
email-marketingnurture-sequencesmarketing-loopscrm lifecycle marketer
roundupbeginner
This Week in AI Marketing #07: Workflows Beat Prompts
Marketing automation rebuilds around AI-native workflows, plus notes on context management, connector sprawl, and a stat on time reclaimed.
marketing-automationweekly-roundupworkflowsmarketing ops manager
explainerintermediate
The CMO's Guide to AI Budgeting
How to budget for AI in marketing without buying shelfware or starving the winners — a practical framework for tools, tokens, people, and proof.
ai-budgetingcmo-strategymarketing-spendmarketing leader
glossarybeginner
llms.txt
llms.txt is a proposed web standard — a Markdown file at a site's root that points AI systems to a site's most important, LLM-friendly content.
llms-txtai-crawlersweb-standardsseo geo strategist
guideintermediate
AI Agents for CRM and Lifecycle Marketing: A Practical Guide
How lifecycle and CRM teams are using AI agents for segmentation, journey orchestration, win-back, and retention — with real deployment patterns and guardrails.
ai-agentscrmlifecycle-marketingcrm lifecycle marketer
guidebeginner
What Is an AI Agent? A Marketer's Guide
A plain-language breakdown of AI agents — what they are, how they work, and where marketers are already using them.
ai-agentsbasicsautomationcontent marketer
glossary
AI Agent
A system that can autonomously perceive inputs, plan a sequence of actions, use tools, and iterate toward a goal — without human instruction at each step.
fundamentalsagents
glossary
RAG (Retrieval-Augmented Generation)
A technique where an AI model retrieves relevant documents from an external knowledge base before generating a response, grounding its output in real, up-to-date information.
fundamentalsragsearch
trend-notebeginner
Zero-Click Marketing
When AI answers satisfy the query, the answer itself becomes the touchpoint — and marketing has to work without the visit.
zero-clickai-searchbrand-visibilitycontent marketer
learning-pathbeginner
AI Content Path: Content Marketing Mastery With AI
A staged path for content marketers: from responsible AI-assisted writing to a full production system with quality gates, GEO-aware structure, and a performance loop.
content-marketingai-writingcontent-strategycontent marketer
learning-pathbeginner
AI Marketing Foundations: Learning Path
A structured learning path for marketers new to AI — covering core concepts, practical tools, and first workflows to implement.
learning-pathfoundationsbeginnercontent marketer
trend-notebeginner
Video Generation Goes Mainstream
AI video generation has crossed from demo to daily production tool for a wide band of marketing work — raising the creative floor for everyone.
ai-videocreative-productionvideo-marketingcontent marketer
glossary
Token
A token is the unit of text AI models read and generate — roughly three-quarters of a word in English. Tokens determine cost, speed, and context limits.
tokensllmcostmarketing ops manager
workflowintermediate
The GEO Content Optimization Workflow: Audit, Fix, Verify
A repeatable workflow for auditing your existing content's visibility in AI answers and systematically optimizing it for citation in ChatGPT, Perplexity, and Google AI Overviews.
geoaeocontent-optimizationseo geo strategist
tool-analysisintermediate
n8n vs Make vs Zapier for AI Marketing Workflows
A head-to-head comparison of n8n, Make, and Zapier for building AI-powered marketing automations — pricing models, AI capabilities, and which teams should pick which.
n8nmakezapiermarketing ops manager
roundupbeginner
This Week in AI Marketing #06: Video Generation Crosses the Usable Line
AI video moves from novelty to production tool for everyday marketing assets, plus notes on brand consistency and the ad-variant explosion.
ai-videoweekly-roundupcreative-productioncontent marketer
glossarybeginner
Prompt Engineering
Prompt engineering is the practice of designing inputs to AI models — context, examples, instructions, and constraints — to reliably produce useful, on-brand outputs.
prompt-engineeringllm-basicsdefinitionscontent marketer
explainerintermediate
AI Content and Authenticity: Disclosure, Trust, and E-E-A-T in the Machine Era
When everyone can generate fluent content, authenticity becomes the differentiator. How disclosure, experience signals, and E-E-A-T actually work in 2026.
content-authenticitye-e-a-tai-disclosurecontent marketer
guidebeginner
Prompt Engineering for Marketers: Patterns That Actually Work
Practical prompt patterns for marketing tasks — briefs, rewrites, analysis, and campaign ideation — with copy-paste templates and the mistakes to avoid.
prompt-engineeringai-contentproductivitycontent marketer
learning-pathbeginner
AI Social Path: Becoming an AI-Powered Social Media Manager
A staged learning path for social media managers who want to use AI across ideation, creation, scheduling, listening, and reporting — without their channels going generic.
social-mediaai-toolscontent-creationsocial media manager
trend-notebeginner
Browser Agents and Marketing
AI agents that browse the web on users' behalf are redefining what a 'visitor' is — and what websites must do to convert one.
browser-agentsai-agentsweb-analyticsanalytics lead
guidebeginner
AI Email Marketing: A Practical Guide to the Whole Program
How to apply AI across your email program — ideation, copy, personalization, send-time, deliverability, and reporting — with realistic expectations at each step.
email-marketingai-copywritingpersonalizationcrm lifecycle marketer
workflowintermediate
Build a Weekly Competitor Intel Agent That Actually Gets Read
Set up an AI agent that monitors competitor websites, pricing, ads, and content every week and delivers a short brief of what changed and why it matters.
competitive-intelligenceai-agentsmonitoringgrowth marketer
tool-analysisbeginner
AI Content Writing Tools in 2026: A Buyer's Field Guide
How the AI writing tool market has consolidated in 2026 — general assistants vs. marketing platforms vs. SEO-focused tools, and what each is actually worth.
ai-writingcontent-toolscopywritingcontent marketer
glossary
Fine-Tuning
Fine-tuning is additional training that adapts a foundation AI model to a specific task, style, or domain using your own examples — teaching behavior, not facts.
fine-tuningllmbrand-voicemarketing ops manager
roundupbeginner
This Week in AI Marketing #05: Social Teams Become Media Labs
AI is turning small social teams into full media operations, plus notes on comment intelligence, format testing, and creator disclosure norms.
ai-social-mediaweekly-roundupshort-form-videosocial media manager
explainerintermediate
The AI Marketing Org Chart: How Teams Actually Restructure
AI doesn't just change marketing tasks — it changes the shape of the team. What the emerging AI-era marketing org actually looks like, role by role.
marketing-orgteam-structureai-transformationmarketing leader
glossarybeginner
Marketing Loops
Marketing loops are self-improving AI workflows that feed performance results back into the next run, so campaigns learn and improve automatically over time.
marketing-loopsai-workflowsdefinitionsmarketing ops manager
guideintermediate
Marketing Loops: Building Self-Improving AI Workflows
Marketing loops are AI workflows that feed performance data back into the next run, so campaigns improve automatically. Here's how to design and ship your first one.
marketing-loopsai-workflowsautomationmarketing ops manager
learning-pathintermediate
Agent Builder Path: From Marketer to Marketing Agent Builder
A staged path for marketers who want to go beyond prompting and actually build AI agents that monitor, research, and act on marketing tasks autonomously.
ai-agentsautomationagent-buildingmarketing ops manager
trend-notebeginner
llms.txt Adoption Grows
The llms.txt standard for guiding AI systems through your site is spreading — a low-cost bet on how machine readers will consume the web.
llms-txtai-searchtechnical-seoseo geo strategist
workflowintermediate
Build a Campaign Reporting Agent for Monday-Morning Reports That Write Themselves
Set up an AI agent that pulls campaign data from your ad platforms and analytics every week, writes the narrative, flags anomalies, and delivers a report people actually read.
reportingai-agentsanalyticsanalytics lead
tool-analysisbeginner
AI Video Tools for Marketers in 2026: The Honest Landscape
A marketer's guide to the 2026 AI video tool landscape — text-to-video, avatar tools, and editing copilots, with honest guidance on what each is actually good for.
ai-videocreative-toolsvideo-marketingcontent marketer
glossarybeginner
Hallucination (AI)
An AI hallucination is a confident, fluent output that is factually wrong or fabricated — the central quality risk when using AI for marketing content.
hallucinationai-riskscontent-qualitycontent marketer
glossary
System Prompt
A system prompt is the standing instruction set that defines an AI assistant's role, rules, and constraints before any user input arrives — the job description for the model.
promptssystem-promptconfigurationmarketing ops manager
workflowintermediate
AI-Assisted Creative Review: Faster Approvals Without Lowering the Bar
A creative review and approval workflow that uses AI as a first-pass reviewer for brand, compliance, and spec checks — so human reviewers only judge what humans should.
creative-reviewbrand-complianceapproval-workflowmarketing ops manager
roundupbeginner
This Week in AI Marketing #04: Content Volume Hits Its Ceiling
The AI content flood is forcing a quality reset, plus notes on editorial layers, content provenance, and one number on AI-assisted output.
ai-contentweekly-roundupcontent-strategycontent marketer
explainerbeginner
The Small-Team AI Stack: Lean Tooling for Marketing Teams Under 10
A pragmatic blueprint for the AI stack of a sub-10-person marketing team — what to buy, what to skip, and how to sequence adoption without drowning in tools.
ai-stacksmall-teamsmartechgrowth marketer
glossarybeginner
Answer Engine Optimization (AEO)
AEO is the practice of structuring content so AI answer engines like ChatGPT, Perplexity, and Google AI Overviews select and cite it as a source in their responses.
aeoai-citationsdefinitionsseo geo strategist
guidebeginner
AEO: How to Get Cited by AI Answer Engines
Answer Engine Optimization (AEO) is the craft of earning citations in AI-generated answers. Learn the tactics that get your pages quoted by ChatGPT, Perplexity, and AI Overviews.
aeoai-citationsanswer-enginesseo geo strategist
trend-notebeginner
AI Brand Monitoring Matures
Tracking what AI systems say about your brand is becoming a discipline — with tools, cadences, and correction playbooks to match.
brand-monitoringai-searchreputationseo geo strategist
tool-analysisbeginner
AI Email Marketing Tools in 2026: What's Real Behind the 'AI-Powered' Label
A clear-eyed guide to AI features in email marketing platforms — which capabilities move revenue, which are demo-ware, and how to evaluate the 2026 field.
email-marketingai-copywritinglifecycle-marketingcrm lifecycle marketer
learning-pathbeginner
GEO Mastery Path: From Zero to AI Search Practitioner
A staged learning path that takes you from understanding what generative engine optimization is to running a full GEO program with measurement, optimization, and reporting.
geoaeoai-searchseo geo strategist
comparisonbeginner
SEO vs GEO: What Actually Changes
Beyond the acronym wars — what genuinely changes when you optimize for AI answers instead of search rankings, and what stays exactly the same.
seogeoai-searchseo geo strategist
workflowbeginner
The AI Blog Writing Workflow: Brief to Publish Without the Slop
A five-stage blog production workflow that uses AI at the brief, research, draft, edit, and publish stages — while keeping a human editor in charge of quality.
blog-writingcontent-productioneditingcontent marketer
roundupbeginner
This Week in AI Marketing #03: Agents Get a Job Description
Marketing teams are moving from AI chat to AI agents with defined scopes, plus notes on approval workflows and agent-readable content.
ai-agentsweekly-roundupmarketing-opsmarketing ops manager
glossarybeginner
Generative Engine Optimization (GEO)
GEO is the practice of optimizing content and brand presence to be retrieved, cited, and recommended by AI systems like ChatGPT, Perplexity, and Google AI Overviews.
geoai-searchdefinitionsseo geo strategist
guidebeginner
What Is GEO? Generative Engine Optimization Explained
Generative Engine Optimization (GEO) is how brands earn visibility inside AI answers from ChatGPT, Perplexity, and Google AI Overviews. Here's how it works and how to start.
geoai-searchanswer-enginesseo geo strategist
trend-notebeginner
The Rise of Prompt Ops
Prompt and context management is hardening into a marketing ops discipline — with libraries, versioning, and quality gates replacing tribal knowledge.
prompt-opsmarketing-opsai-workflowsmarketing ops manager
roundupbeginner
This Week in AI Marketing #02: Answer Engines Eat the Funnel
AI answer engines keep compressing the discovery funnel, plus tactical notes on prompt libraries and a directional stat on zero-click growth.
ai-searchgeoweekly-roundupseo geo strategist